PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.066300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 314aa    MW: 34771.8 Da    PI: 7.1003
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.066300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.72.1e-32159215258
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     dDgy+WrKYGqK++k+s++prsYYrC+ ++C++kk+vers edp++++itYeg H h
  Cucsa.066300.1 159 DDGYKWRKYGQKSIKNSPNPRSYYRCSNPRCSAKKQVERSIEDPDIFIITYEGLHLH 215
                     8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081126.9153218IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.1E-30153215IPR003657WRKY domain
SuperFamilySSF1182906.54E-27156215IPR003657WRKY domain
SMARTSM007742.5E-36158217IPR003657WRKY domain
PfamPF031067.2E-26159215IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
SQQKAPPYIF HSHLLHFILS SSSSSKFQSL SSSSMDSLAA IPWSDTHTTV SDDHLFTLTN  60
LLHDDENHAS SPLFLLPQDA DDNNRAIRVP VPGGATYFGP TIEDIENALS IGTPRSKDLQ  120
SHTQISHTGF SIVERANLNK VEHKYSLRIK SCGGNMVADD GYKWRKYGQK SIKNSPNPRS  180
YYRCSNPRCS AKKQVERSIE DPDIFIITYE GLHLHFAYPF FLMGQSPQAQ SPTKKPKTID  240
PEQPEAHEKP SFLDPIESSG SQGLLEDMVP WLIRNPSTHH NALSNSSSCL SHRSPPPTPP  300
SPSTSPTFIT SCF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-211572151371WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818881e-174LN681888.1 Cucumis melo genomic scaffold, anchoredscaffold00002.
GenBankLN7132621e-174LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004142202.10.0PREDICTED: probable WRKY transcription factor 49
TrEMBLA0A0A0L0Y80.0A0A0A0L0Y8_CUCSA; Uncharacterized protein
STRINGGLYMA07G16040.25e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71183449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.16e-48WRKY DNA-binding protein 49